APOBEC2 Antikörper (Middle Region)

Produktnummer ABIN633501

Der Kaninchen Polyklonal anti-APOBEC2 Antikörper (ABIN633501) detektiert spezifisch APOBEC2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für APOBEC2 Antikörper (Middle Region) (ABIN633501)

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APOBEC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ApoBEC2 antibody was raised against the middle region of APOBEC2

Aufreinigung: Affinity purified

Immunogen: ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC2 Blocking Peptide, (ABIN937110), is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC2

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Andere Bezeichnung: ApoBEC2

Hintergrund: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Molekulargewicht: 26 kDa (MW of target protein)