CSTF3 Antikörper (N-Term)

Produktnummer ABIN633455

Der Kaninchen Polyklonal anti-CSTF3 Antikörper wird verwendet zum Nachweis von CSTF3 in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio). Er wurde validiert für WB.

Kurzübersicht für CSTF3 Antikörper (N-Term) (ABIN633455)

Target: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSTF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSTF3 Antikörper

Bindungsspezifität: N-Term

Spezifität: CSTF3 antibody was raised against the N terminal of CSTF3

Aufreinigung: Affinity purified

Immunogen: CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSTF3 Blocking Peptide, (ABIN936098), is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSTF3

Target: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Andere Bezeichnung: CSTF3

Hintergrund: CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.

Molekulargewicht: 79 kDa (MW of target protein)