CARS Antikörper (Middle Region)

Produktnummer ABIN633421

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CARS in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für CARS Antikörper (Middle Region) (ABIN633421)

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CARS Antikörper

Bindungsspezifität: Middle Region

Spezifität: CARS antibody was raised against the middle region of CARS

Aufreinigung: Affinity purified

Immunogen: CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CARS Blocking Peptide, (ABIN5612627), is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CARS

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Andere Bezeichnung: CARS

Hintergrund: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Molekulargewicht: 95 kDa (MW of target protein)