DAZ3 Antikörper (Middle Region)

Produktnummer ABIN633418

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DAZ3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für DAZ3 Antikörper (Middle Region) (ABIN633418)

Target: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZ3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DAZ3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DAZ3 antibody was raised against the middle region of DAZ3

Aufreinigung: Affinity purified

Immunogen: DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZ3 Blocking Peptide, (ABIN5613124), is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZ3

Target: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Andere Bezeichnung: DAZ3

Hintergrund: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.

Molekulargewicht: 49 kDa (MW of target protein)