RBMY1A1 Antikörper (N-Term)

Produktnummer ABIN633380

Der Kaninchen Polyklonal anti-RBMY1A1 Antikörper wird verwendet zum Nachweis von RBMY1A1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für RBMY1A1 Antikörper (N-Term) (ABIN633380)

Target: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMY1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBMY1A1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBMY1 A1 antibody was raised against the N terminal of RBMY1 1

Aufreinigung: Affinity purified

Immunogen: RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMY1A1 Blocking Peptide, (ABIN5615807), is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMY1A1

Target: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Andere Bezeichnung: RBMY1A1

Hintergrund: RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Molekulargewicht: 41 kDa (MW of target protein)