In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1) Antikörper

Antigen

Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1)

Synonyme Gababrbp, Marlin-1, 5830437M04Rik, C330021K24Rik, JAMIP1, MARLIN1, FLJ31564, MGC125191, MGC125215, MGC81051, MGC166311
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN633295
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung JAKMIP1
Immunogen JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
Beschreibung JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
Molekulargewicht 97 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAKMIP1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternativen

Alternativen zu Antigen "Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1)", Typ "Antikörper" finden
Wirte Kaninchen (3)
Reaktivitäten Human (3), Rind (Kuh) (1), Hund (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (3), ELISA (1), Enzyme Immunoassay (EIA) (1), Immunhistochemie (IHC) (1)
Epitope Center (1)