SHPRH Antikörper (N-Term)

Produktnummer ABIN633252

Der Kaninchen Polyklonal anti-SHPRH Antikörper (ABIN633252) detektiert spezifisch SHPRH in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SHPRH Antikörper (N-Term) (ABIN633252)

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHPRH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SHPRH Antikörper

Bindungsspezifität: N-Term

Spezifität: SHPRH antibody was raised against the N terminal of SHPRH

Aufreinigung: Affinity purified

Immunogen: SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHPRH Blocking Peptide, (ABIN5616134), is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHPRH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHPRH

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Andere Bezeichnung: SHPRH

Hintergrund: SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.

Molekulargewicht: 190 kDa (MW of target protein)