XPOT Antikörper

Produktnummer ABIN633241

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch XPOT in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für XPOT Antikörper (ABIN633241)

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPOT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XPOT Antikörper

Aufreinigung: Affinity purified

Immunogen: XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XPOT Blocking Peptide, (ABIN5617045), is also available for use as a blocking control in assays to test for specificity of this XPOT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XPOT

Target: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Andere Bezeichnung: XPOT

Hintergrund: XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.

Molekulargewicht: 110 kDa (MW of target protein)