SF3B3 Antikörper (Middle Region)

Produktnummer ABIN633219

Der Kaninchen Polyklonal anti-SF3B3 Antikörper (ABIN633219) detektiert spezifisch SF3B3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SF3B3 Antikörper (Middle Region) (ABIN633219)

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3B3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SF3B3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SF3 B3 antibody was raised against the middle region of SF3 3

Aufreinigung: Affinity purified

Immunogen: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B3 Blocking Peptide, (ABIN5616090), is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3B3

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Andere Bezeichnung: SF3B3

Hintergrund: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molekulargewicht: 135 kDa (MW of target protein)