SF3B3 Antikörper (Middle Region)

Produktnummer ABIN633217

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SF3B3 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SF3B3 Antikörper (Middle Region) (ABIN633217)

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3B3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SF3B3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SF3 B3 antibody was raised against the middle region of SF3 3

Aufreinigung: Affinity purified

Immunogen: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B3 Blocking Peptide, (ABIN937843), is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3B3

Target: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Andere Bezeichnung: SF3B3

Hintergrund: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Molekulargewicht: 135 kDa (MW of target protein)