ADAMTS18 Antikörper (N-Term)

Produktnummer ABIN633175

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ADAMTS18 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für ADAMTS18 Antikörper (N-Term) (ABIN633175)

Target: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAMTS18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAMTS18 Antikörper

Bindungsspezifität: N-Term

Spezifität: ADAMTS18 antibody was raised against the N terminal of ADAMTS18

Aufreinigung: Affinity purified

Immunogen: ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAMTS18 Blocking Peptide, (ABIN938526), is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAMTS18

Target: ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))

Andere Bezeichnung: ADAMTS18

Hintergrund: ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.

Molekulargewicht: 104 kDa (MW of target protein)