SERPINB4 Antikörper

Produktnummer ABIN633159

Der Kaninchen Polyklonal anti-SERPINB4 Antikörper (ABIN633159) detektiert spezifisch SERPINB4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SERPINB4 Antikörper (ABIN633159)

Target: SERPINB4 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SERPINB4 Antikörper

Aufreinigung: Affinity purified

Immunogen: SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB4 Blocking Peptide, (ABIN5616067), is also available for use as a blocking control in assays to test for specificity of this SERPINB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB4

Target: SERPINB4 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4))

Andere Bezeichnung: SERPINB4

Hintergrund: SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.

Molekulargewicht: 45 kDa (MW of target protein)