ALDH1A1 Antikörper

Antigen: ALDH1A1

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN633157

Produktbeschreibung

Immunogen: ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Beschreibung: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Molekulargewicht: 55 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1A1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Stammzellen, Hämopoetische Vorläufer, Signaltransduktion, Metabolismus