In den Warenkorb
Bestellen Sie auch über:
 |
+49 (0)241 95 163 153 |
 |
+49 (0)241 95 163 155 |
ASZ1 Antikörper
| Antigen | ASZ1 |
| Klonalität | Polyklonal |
| Wirt |
Kaninchen |
| Applikation |
Western Blot (WB)
|
| Produktnummer | ABIN633152 |
| Menge | 50 ug (1 mg/ml) |
| Preis | 432,69 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 5 bis 7 Werktagen |
Produktbeschreibung
| Immunogen | ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR |
| Beschreibung | ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. |
| Molekulargewicht | 53 kDa (MW of target protein) |
Anwendungen
| Konzentration | 1 mg/ml |
| Reinigung | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASZ1 antibody in PBS |
| Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Forschungsgebiet | Organogenese, Zellzyklus, Metabolismus, Tyrosinkinasen |
