SCG2 Antikörper

Produktnummer ABIN633054

Der Kaninchen Polyklonal anti-SCG2 Antikörper (ABIN633054) detektiert spezifisch SCG2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SCG2 Antikörper (ABIN633054)

Target: SCG2 (Secretogranin II (SCG2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCG2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCG2 Blocking Peptide, (ABIN939716), is also available for use as a blocking control in assays to test for specificity of this SCG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCG2

Target: SCG2 (Secretogranin II (SCG2))

Andere Bezeichnung: SCG2

Hintergrund: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Molekulargewicht: 71 kDa (MW of target protein)