AMN1 Antikörper

Produktnummer ABIN632997

Der Kaninchen Polyklonal anti-AMN1 Antikörper (ABIN632997) detektiert spezifisch AMN1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für AMN1 Antikörper (ABIN632997)

Target: AMN1 (Antagonist of Mitotic Exit Network 1 Homolog (AMN1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AMN1 Antikörper

Aufreinigung: Affinity purified

Immunogen: AMN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMN1 Blocking Peptide, (ABIN5612048), is also available for use as a blocking control in assays to test for specificity of this AMN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMN1

Target: AMN1 (Antagonist of Mitotic Exit Network 1 Homolog (AMN1))

Andere Bezeichnung: AMN1

Hintergrund: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)