PDXP Antikörper

Produktnummer ABIN632951

Der Kaninchen Polyklonal anti-PDXP Antikörper wird verwendet zum Nachweis von PDXP in Proben von Maus und Human. Er wurde validiert für WB.

Kurzübersicht für PDXP Antikörper (ABIN632951)

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDXP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDXP Antikörper

Aufreinigung: Affinity purified

Immunogen: PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDXP Blocking Peptide, (ABIN937508), is also available for use as a blocking control in assays to test for specificity of this PDXP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDXP

Target: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Andere Bezeichnung: PDXP

Hintergrund: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.

Molekulargewicht: 32 kDa (MW of target protein)