DCUN1D4 Antikörper

Produktnummer ABIN632786

Der Kaninchen Polyklonal anti-DCUN1D4 Antikörper wird verwendet zum Nachweis von DCUN1D4 in Proben von Maus, Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für DCUN1D4 Antikörper (ABIN632786)

Target: DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCUN1D4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DCUN1D4 Antikörper

Aufreinigung: Affinity purified

Immunogen: DCUN1 D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCUN1D4 Blocking Peptide, (ABIN936151), is also available for use as a blocking control in assays to test for specificity of this DCUN1D4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCUN1D4

Target: DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))

Andere Bezeichnung: DCUN1D4

Hintergrund: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Molekulargewicht: 34 kDa (MW of target protein)