In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

N-Acylneuraminate-9-Phosphatase (NANP) Antikörper

Antigen

N-Acylneuraminate-9-Phosphatase (NANP)

Synonyme HDHD4, MGC26833, C20orf147, dJ694B14.3, Hdhd4, MGC103377, 1600031M04Rik, A130094D17Rik, MGC105812, RGD1306009
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632748
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung NANP
Immunogen NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS
Beschreibung The function of NANP protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 28 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NANP antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Metabolismus, Enzyme

Alternativen

Alternativen zu Antigen "N-Acylneuraminate-9-Phosphatase (NANP)", Typ "Antikörper" finden
Wirte Kaninchen (13), Maus (7)
Reaktivitäten Human (16), Maus (2), Huhn (1), Rind (Kuh) (1), Hund (1), Ratte (Rattus) (1)
Applikationen Immunhistochemie (Paraffinschnitte) (IHC (p)) (10), Western Blot (WB) (8), Immunfluoreszenz (IF) (5), ELISA (Detektionsantikörper) (2), Durchflusszytometrie (FACS) (2), Dot Blot (Dot) (1)
Epitope N-Term (1)