GPRASP2 Antikörper (Middle Region)

Produktnummer ABIN632717

Der Kaninchen Polyklonal anti-GPRASP2 Antikörper wird verwendet zum Nachweis von GPRASP2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für GPRASP2 Antikörper (Middle Region) (ABIN632717)

Target: GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPRASP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPRASP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPRASP2 antibody was raised against the middle region of GPRASP2

Aufreinigung: Affinity purified

Immunogen: GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPRASP2 Blocking Peptide, (ABIN938048), is also available for use as a blocking control in assays to test for specificity of this GPRASP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPRASP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPRASP2

Target: GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))

Andere Bezeichnung: GPRASP2

Hintergrund: The function of FAM14A protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 94 kDa (MW of target protein)