In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Chromosome 20 Open Reading Frame 141 (C20orf141) Antikörper

Antigen

Chromosome 20 Open Reading Frame 141 (C20orf141)

Synonyme MGC26144, dJ860F19.4
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632707
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung C20ORF141
Immunogen C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG
Beschreibung The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 17 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF141 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternativen

Alternativen zu Antigen "Chromosome 20 Open Reading Frame 141 (C20orf141)", Typ "Antikörper" finden
Wirte Kaninchen (5)
Reaktivitäten Human (4), Rind (Kuh) (1), Maus (1)
Applikationen Western Blot (WB) (5), ELISA (2)