SERPINB1 Antikörper

Produktnummer ABIN632703

Der Kaninchen Polyklonal anti-SERPINB1 Antikörper (ABIN632703) detektiert spezifisch SERPINB1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SERPINB1 Antikörper (ABIN632703)

Target: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SERPINB1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB1 Blocking Peptide, (ABIN5616064), is also available for use as a blocking control in assays to test for specificity of this SERPINB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB1

Target: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Andere Bezeichnung: SERPINB1

Hintergrund: SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.

Molekulargewicht: 43 kDa (MW of target protein)