PM20D2 Antikörper (Middle Region)

Produktnummer ABIN632689

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PM20D2 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für PM20D2 Antikörper (Middle Region) (ABIN632689)

Target: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PM20D2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PM20D2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PM20 D2 antibody was raised against the middle region of PM20 2

Aufreinigung: Affinity purified

Immunogen: PM20 D2 antibody was raised using the middle region of PM20 2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PM20D2 Blocking Peptide, (ABIN939124), is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PM20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PM20D2

Target: PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))

Andere Bezeichnung: PM20D2

Hintergrund: PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Molekulargewicht: 48 kDa (MW of target protein)