BDH2 Antikörper (Middle Region)

Produktnummer ABIN632667

Der Kaninchen Polyklonal anti-BDH2 Antikörper (ABIN632667) detektiert spezifisch BDH2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für BDH2 Antikörper (Middle Region) (ABIN632667)

Target: BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BDH2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BDH2 antibody was raised against the middle region of BDH2

Aufreinigung: Affinity purified

Immunogen: BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BDH2 Blocking Peptide, (ABIN5612309), is also available for use as a blocking control in assays to test for specificity of this BDH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BDH2

Target: BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))

Andere Bezeichnung: BDH2

Hintergrund: BDH2 is a dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. It also acts as a 3-hydroxybutyrate dehydrogenase.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Monocarboxylic Acid Catabolic Process