CDC27 Antikörper

Produktnummer ABIN632660

Der Kaninchen Polyklonal anti-CDC27 Antikörper wird verwendet zum Nachweis von CDC27 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CDC27 Antikörper (ABIN632660)

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDC27 Antikörper

Aufreinigung: Affinity purified

Immunogen: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC27 Blocking Peptide, (ABIN939900), is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC27

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Andere Bezeichnung: CDC27

Hintergrund: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Molekulargewicht: 92 kDa (MW of target protein)