CNDP2 Antikörper

Produktnummer ABIN632658

Der Kaninchen Polyklonal anti-CNDP2 Antikörper (ABIN632658) detektiert spezifisch CNDP2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CNDP2 Antikörper (ABIN632658)

Target: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNDP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CNDP2 Antikörper

Aufreinigung: Affinity purified

Immunogen: CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNDP2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNDP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNDP2

Target: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Andere Bezeichnung: CNDP2

Hintergrund: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase.

Molekulargewicht: 53 kDa (MW of target protein)