GAN Antikörper (Middle Region)

Produktnummer ABIN632648

Der Kaninchen Polyklonal anti-GAN Antikörper wird verwendet zum Nachweis von GAN in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für GAN Antikörper (Middle Region) (ABIN632648)

Target: GAN (Gigaxonin (GAN))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAN Antikörper

Bindungsspezifität: Middle Region

Spezifität: GAN antibody was raised against the middle region of GAN

Aufreinigung: Affinity purified

Immunogen: GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAN Blocking Peptide, (ABIN939609), is also available for use as a blocking control in assays to test for specificity of this GAN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAN

Target: GAN (Gigaxonin (GAN))

Andere Bezeichnung: GAN

Hintergrund: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Molekulargewicht: 66 kDa (MW of target protein)