CCBE1 Antikörper (Middle Region)

Produktnummer ABIN632573

Der Kaninchen Polyklonal anti-CCBE1 Antikörper wird verwendet zum Nachweis von CCBE1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CCBE1 Antikörper (Middle Region) (ABIN632573)

Target: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCBE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCBE1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CCBE1 antibody was raised against the middle region of CCBE1

Aufreinigung: Affinity purified

Immunogen: CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCBE1 Blocking Peptide, (ABIN5612702), is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCBE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCBE1

Target: CCBE1 (Collagen and Calcium Binding EGF Domains 1 (CCBE1))

Andere Bezeichnung: CCBE1

Hintergrund: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.

Molekulargewicht: 44 kDa (MW of target protein)