AGGF1 Antikörper (Middle Region)

Produktnummer ABIN632559

Der Kaninchen Polyklonal anti-AGGF1 Antikörper (ABIN632559) detektiert spezifisch AGGF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für AGGF1 Antikörper (Middle Region) (ABIN632559)

Target: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGGF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGGF1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: AGGF1 antibody was raised against the middle region of AGGF1

Aufreinigung: Affinity purified

Immunogen: AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGGF1 Blocking Peptide, (ABIN938204), is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGGF1

Target: AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))

Andere Bezeichnung: AGGF1

Hintergrund: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.

Molekulargewicht: 81 kDa (MW of target protein)