GALM Antikörper

Produktnummer ABIN632539

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GALM in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für GALM Antikörper (ABIN632539)

Target: GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GALM Antikörper

Aufreinigung: Affinity purified

Immunogen: GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALM Blocking Peptide, (ABIN5613714), is also available for use as a blocking control in assays to test for specificity of this GALM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALM

Target: GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))

Andere Bezeichnung: GALM

Hintergrund: GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.

Molekulargewicht: 38 kDa (MW of target protein)