ACP5 Antikörper (N-Term)

Produktnummer ABIN632484

Der Kaninchen Polyklonal anti-ACP5 Antikörper (ABIN632484) detektiert spezifisch ACP5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ACP5 Antikörper (N-Term) (ABIN632484)

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACP5 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACP5 antibody was raised against the N terminal of ACP5

Aufreinigung: Affinity purified

Immunogen: ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP5 Blocking Peptide, (ABIN937465), is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP5

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Andere Bezeichnung: ACP5

Hintergrund: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis