PLEKHA9 Antikörper

Produktnummer ABIN632469

Der Kaninchen Polyklonal anti-PLEKHA9 Antikörper (ABIN632469) detektiert spezifisch PLEKHA9 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PLEKHA9 Antikörper (ABIN632469)

Target: PLEKHA9 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 9 (PLEKHA9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLEKHA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLEKHA9 Antikörper

Aufreinigung: Affinity purified

Immunogen: PLEKHA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLEKHA9 Blocking Peptide, (ABIN937653), is also available for use as a blocking control in assays to test for specificity of this PLEKHA9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHA9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLEKHA9

Target: PLEKHA9 (Pleckstrin Homology Domain Containing, Family A (Phosphoinositide Binding Specific) Member 9 (PLEKHA9))

Andere Bezeichnung: PLEKHA9

Hintergrund: The function of PLEKHA9 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)