PDP2 Antikörper (Middle Region)

Produktnummer ABIN632420

Der Kaninchen Polyklonal anti-PDP2 Antikörper wird verwendet zum Nachweis von PDP2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PDP2 Antikörper (Middle Region) (ABIN632420)

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PDP2 antibody was raised against the middle region of PDP2

Aufreinigung: Affinity purified

Immunogen: PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDP2 Blocking Peptide, (ABIN5615293), is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDP2

Target: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Andere Bezeichnung: PDP2

Hintergrund: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Molekulargewicht: 60 kDa (MW of target protein)