In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Sec1 Family Domain Containing 1 (SCFD1) Antikörper

Antigen

Sec1 Family Domain Containing 1 (SCFD1)

Synonyme SLY1, RA410, KIAA0917, STXBP1L2, C14orf163, 3110021P21Rik, MGC83661
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632406
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung SCFD1
Immunogen SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME
Beschreibung The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 65 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCFD1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Sec1 Family Domain Containing 1 (SCFD1)", Typ "Antikörper" finden
Wirte Kaninchen (6), Maus (4)
Reaktivitäten Human (10), Ratte (Rattus) (6), Maus (5), Hund (4), Affe (2), Rind (Kuh) (1)
Applikationen Western Blot (WB) (8), Immunhistochemie (IHC) (4), ELISA (1), Enzyme Immunoassay (EIA) (1), Durchflusszytometrie (FACS) (1), Immunpräzipitation (IP) (1)
Epitope C-Term (2), AA 179-335 (1)