UEVLD Antikörper (Middle Region)

Produktnummer ABIN632376

Der Kaninchen Polyklonal anti-UEVLD Antikörper (ABIN632376) detektiert spezifisch UEVLD in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für UEVLD Antikörper (Middle Region) (ABIN632376)

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UEVLD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UEVLD Antikörper

Bindungsspezifität: Middle Region

Spezifität: UEVLD antibody was raised against the middle region of UEVLD

Aufreinigung: Affinity purified

Immunogen: UEVLD antibody was raised using the middle region of UEVLD corresponding to a region with amino acids SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UEVLD Blocking Peptide, (ABIN5616896), is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UEVLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UEVLD

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Andere Bezeichnung: UEVLD

Hintergrund: UEVLD is a possible negative regulator of polyubiquitination.

Molekulargewicht: 42 kDa (MW of target protein)