In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

DPP3 Antikörper

Antigen

DPP3

Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632199
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Immunogen DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE
Beschreibung DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.
Molekulargewicht 82 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPP3 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "DPP3", Typ "Antikörper" finden
Wirte Maus (21), Kaninchen (4)
Reaktivitäten Human (16), Rind (Kuh) (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (24), Durchflusszytometrie (FACS) (8), Enzyme Immunoassay (EIA) (2), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (2), Immunhistochemie (IHC) (2), ELISA (1), ELISA (Detektionsantikörper) (1), Immunfluoreszenz (IF) (1)