AP3M2 Antikörper (Middle Region)

Produktnummer ABIN632155

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch AP3M2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für AP3M2 Antikörper (Middle Region) (ABIN632155)

Target: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP3M2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AP3M2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: AP3 M2 antibody was raised against the middle region of AP3 2

Aufreinigung: Affinity purified

Immunogen: AP3 M2 antibody was raised using the middle region of AP3 2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP3M2 Blocking Peptide, (ABIN5612099), is also available for use as a blocking control in assays to test for specificity of this AP3M2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AP3M2

Target: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Andere Bezeichnung: AP3M2

Hintergrund: AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Molekulargewicht: 47 kDa (MW of target protein)