TRIB3 Antikörper

Produktnummer ABIN632145

Der Kaninchen Polyklonal anti-TRIB3 Antikörper (ABIN632145) detektiert spezifisch TRIB3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TRIB3 Antikörper (ABIN632145)

Target: TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIB3 Antikörper

Aufreinigung: Affinity purified

Immunogen: TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIB3 Blocking Peptide, (ABIN936257), is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIB3

Target: TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))

Andere Bezeichnung: TRIB3

Hintergrund: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Lipid Metabolism by PPARalpha