AGAP2 Antikörper (Middle Region)

Produktnummer ABIN632064

Der Kaninchen Polyklonal anti-AGAP2 Antikörper (ABIN632064) detektiert spezifisch AGAP2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für AGAP2 Antikörper (Middle Region) (ABIN632064)

Target: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGAP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CENTG1 antibody was raised against the middle region of CENTG1

Aufreinigung: Affinity purified

Immunogen: CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENTG1 Blocking Peptide, (ABIN936626), is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGAP2

Target: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Andere Bezeichnung: CENTG1

Hintergrund: CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.

Molekulargewicht: 90 kDa (MW of target protein)