ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) Antikörper

Antigen: ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2)

Synonyme: PIKE, GGAP2, CENTG1, FLJ16430, KIAA0167, Pike, Centg1, mKIAA0167, AGAP1, AGAP2

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN632064

Produktbeschreibung

Weitere Bezeichnung: CENTG1

Immunogen: CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG

Beschreibung: CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.

Molekulargewicht: 90 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENTG1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar