PAD4 Antikörper (Middle Region)

Produktnummer ABIN631895

Der Kaninchen Polyklonal anti-PAD4 Antikörper wird verwendet zum Nachweis von PAD4 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für PAD4 Antikörper (Middle Region) (ABIN631895)

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAD4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PADI4 antibody was raised against the middle region of PADI4

Aufreinigung: Affinity purified

Immunogen: PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PADI4 Blocking Peptide, (ABIN5615188), is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAD4

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Andere Bezeichnung: PADI4

Hintergrund: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Molekulargewicht: 74 kDa (MW of target protein)