APOBEC4 Antikörper

Produktnummer ABIN631877

Der Kaninchen Polyklonal anti-APOBEC4 Antikörper wird verwendet zum Nachweis von APOBEC4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für APOBEC4 Antikörper (ABIN631877)

Target: APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APOBEC4 Antikörper

Aufreinigung: Affinity purified

Immunogen: ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC4 Blocking Peptide, (ABIN940496), is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC4

Target: APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))

Andere Bezeichnung: ApoBEC4

Hintergrund: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.

Molekulargewicht: 41 kDa (MW of target protein)