HIPK4 Antikörper (Middle Region)

Produktnummer ABIN631807

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HIPK4 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für HIPK4 Antikörper (Middle Region) (ABIN631807)

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HIPK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HIPK4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HIPK4 antibody was raised against the middle region of HIPK4

Aufreinigung: Affinity purified

Immunogen: HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIPK4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HIPK4

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Andere Bezeichnung: HIPK4

Hintergrund: HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

Molekulargewicht: 69 kDa (MW of target protein)