KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2) Antikörper

Antigen: KH Domain Containing, RNA Binding, Signal Transduction Associated 2 (KHDRBS2)

Synonyme: Slm1, Slim1, 6330586C16Rik, SLM1, SLM-1, FLJ38664, MGC26664, bA535F17.1, zgc:153588, slm1, slm-1, MGC145973, ba535f17.1

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN631800

Produktbeschreibung

Weitere Bezeichnung: KHDRBS2

Immunogen: KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG

Beschreibung: KHDRBS2 is a RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection.

Molekulargewicht: 39 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS2 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Chromatin und nukleäre Signaltransduktion, Chromatin-Bindungsproteine, DNS/RNS

Beschränkungen: Nur für Forschungszwecke einsetzbar