HB Antikörper

Antigen: HB

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN631771

Produktbeschreibung

Immunogen: HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP

Beschreibung: Hb is a gap class segmentation protein that controls development of head structures.

Molekulargewicht: 83 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HB antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar