In den Warenkorb
Bestellen Sie auch über:
![]() |
+49 (0)241 95 163 153 |
![]() |
+49 (0)241 95 163 155 |
HB Antikörper
| Antigen | HB |
| Klonalität | Polyklonal |
| Wirt |
Kaninchen |
| Applikation |
Western Blot (WB)
|
| Produktnummer | ABIN631771 |
| Menge | 50 ug (1 mg/ml) |
| Preis | 432,69 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 5 bis 7 Werktagen |
Produktbeschreibung
| Immunogen | HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP |
| Beschreibung | Hb is a gap class segmentation protein that controls development of head structures. |
| Molekulargewicht | 83 kDa (MW of target protein) |
Anwendungen
| Konzentration | 1 mg/ml |
| Reinigung | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HB antibody in PBS |
| Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |



