HEXDC Antikörper

Produktnummer ABIN631765

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HEXDC in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HEXDC Antikörper (ABIN631765)

Target: HEXDC (Hexosaminidase D (HEXDC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEXDC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HEXDC Antikörper

Aufreinigung: Affinity purified

Immunogen: HEXDC antibody was raised using a synthetic peptide corresponding to a region with amino acids CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEXDC Blocking Peptide, (ABIN937170), is also available for use as a blocking control in assays to test for specificity of this HEXDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEXDC

Target: HEXDC (Hexosaminidase D (HEXDC))

Andere Bezeichnung: HEXDC

Hintergrund: HEXDC has hexosaminidase activity.

Molekulargewicht: 63 kDa (MW of target protein)