C22orf9 Antikörper (Middle Region)

Produktnummer ABIN631718

Der Kaninchen Polyklonal anti-C22orf9 Antikörper wird verwendet zum Nachweis von C22orf9 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für C22orf9 Antikörper (Middle Region) (ABIN631718)

Target: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C22orf9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C22orf9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C22 ORF9 antibody was raised against the middle region of C22 rf9

Aufreinigung: Affinity purified

Immunogen: C22 ORF9 antibody was raised using the middle region of C22 rf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C22ORF9 Blocking Peptide, (ABIN938103), is also available for use as a blocking control in assays to test for specificity of this C22ORF9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C22orf9

Target: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Andere Bezeichnung: C22ORF9

Hintergrund: The function of C22orf9 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 46 kDa (MW of target protein)