3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1) Antikörper

Antigen: 3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1)

Synonyme: PIP, BPntase, Sal3, MGC93112, MGC82412, BPNT1, MGC126947

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN631707

Produktbeschreibung

Weitere Bezeichnung: BPNT1

Immunogen: BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Beschreibung: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Molekulargewicht: 29 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BPNT1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Neurologie, DNS/RNS

Beschränkungen: Nur für Forschungszwecke einsetzbar