In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) Antikörper

Antigen

Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12)

Synonyme RMP, gep, NNX3, MGC99644, MGC104623
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631704
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung GNA12
Immunogen GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
Beschreibung GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Molekulargewicht 44 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNA12 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12)", Typ "Antikörper" finden
Wirte Kaninchen (9), Maus (3)
Reaktivitäten Human (12), Huhn (1), Rind (Kuh) (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (9), Enzyme Immunoassay (EIA) (4), ELISA (3), ELISA (Detektionsantikörper) (3), Dot Blot (Dot) (2)
Epitope pSer67 (3), S67 (1)