PCSK4 Antikörper (N-Term)

Produktnummer ABIN631599

Der Kaninchen Polyklonal anti-PCSK4 Antikörper (ABIN631599) detektiert spezifisch PCSK4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PCSK4 Antikörper (N-Term) (ABIN631599)

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCSK4 Antikörper

Bindungsspezifität: N-Term

Spezifität: PCSK4 antibody was raised against the N terminal of PCSK4

Aufreinigung: Affinity purified

Immunogen: PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCSK4 Blocking Peptide, (ABIN5615264), is also available for use as a blocking control in assays to test for specificity of this PCSK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCSK4

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Andere Bezeichnung: PCSK4

Hintergrund: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin.

Molekulargewicht: 83 kDa (MW of target protein)