In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Prostaglandin Reductase 2 (PTGR2) Antikörper

Antigen

Prostaglandin Reductase 2 (PTGR2)

Synonyme PGR2, ZADH1, FLJ39091, FLJ99229, DKFZp686P10120, Zadh1, MGC108784, MGC134348, MGC146252, DKFZp469L2120
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631563
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ZADH1
Immunogen ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
Beschreibung ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
Molekulargewicht 38 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZADH1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Prostaglandin Reductase 2 (PTGR2)", Typ "Antikörper" finden
Wirte Kaninchen (3), Maus (1)
Reaktivitäten Human (4), Maus (2), Ratte (Rattus) (2), Rind (Kuh) (1), Hund (1)
Applikationen Western Blot (WB) (3), ELISA (1), ELISA (Detektionsantikörper) (1)