PTGR2 Antikörper (Middle Region)

Produktnummer ABIN631563

Der Kaninchen Polyklonal anti-PTGR2 Antikörper (ABIN631563) detektiert spezifisch PTGR2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für PTGR2 Antikörper (Middle Region) (ABIN631563)

Target: PTGR2 (Prostaglandin Reductase 2 (PTGR2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PTGR2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ZADH1 antibody was raised against the middle region of Zadh1

Aufreinigung: Affinity purified

Immunogen: ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZADH1 Blocking Peptide, (ABIN939426), is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGR2

Target: PTGR2 (Prostaglandin Reductase 2 (PTGR2))

Andere Bezeichnung: ZADH1

Hintergrund: ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.

Molekulargewicht: 38 kDa (MW of target protein)